TOE1 antibody
-
- Target See all TOE1 Antibodies
- TOE1 (Target of EGR1, Member 1 (Nuclear) (TOE1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TOE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY
- Top Product
- Discover our top product TOE1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TOE1 Blocking Peptide, catalog no. 33R-9872, is also available for use as a blocking control in assays to test for specificity of this TOE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOE1 (Target of EGR1, Member 1 (Nuclear) (TOE1))
- Alternative Name
- TOE1 (TOE1 Products)
- Synonyms
- 4930584N22Rik antibody, 4933424D16Rik antibody, AI413517 antibody, TOE1 antibody, si:dkey-40i22.3 antibody, target of EGR1, exonuclease antibody, target of EGR1, member 1 (nuclear) antibody, TOE1 antibody, Toe1 antibody, toe1 antibody
- Background
- TOE1 belongs to the CAF1 family and 1 C3H1-type zinc finger. TOE1 inhibits cell growth rate and cell cycle. It induces CDKN1A expression as well as TGF-beta expression and mediates the inhibitory growth effect of EGR1.
- Molecular Weight
- 56 kDa (MW of target protein)
-