TCP10 antibody
-
- Target See all TCP10 products
- TCP10 (T-Complex 10 (TCP10))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TCP10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TCP10 Blocking Peptide, catalog no. 33R-2697, is also available for use as a blocking control in assays to test for specificity of this TCP10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TCP10 (T-Complex 10 (TCP10))
- Alternative Name
- TCP10 (TCP10 Products)
- Synonyms
- TCP10A antibody, t-complex 10 antibody, TCP10 antibody
- Background
- The function of TCP10 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 35 kDa (MW of target protein)
-