TTC16 antibody (C-Term)

Catalog No. ABIN631543

Product Details anti-TTC16 Antibody

Target: TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TTC16 antibody was raised against the C terminal of TTC16

Purification: Affinity purified

Immunogen: TTC16 antibody was raised using the C terminal of TTC16 corresponding to a region with amino acids RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTC16 Blocking Peptide, catalog no. 33R-8209, is also available for use as a blocking control in assays to test for specificity of this TTC16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC16

Target: TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))

Alternative Name: TTC16 (TTC16 Products)

Synonyms: 1200002K10Rik antibody, tetratricopeptide repeat domain 16 antibody, TTC16 antibody, Ttc16 antibody

Background: TTC16 contains 8 TPR repeats. The exact function of TTC16 remains unknown.

Molecular Weight: 98 kDa (MW of target protein)