RPL37A antibody (Middle Region)
-
- Target See all RPL37A Antibodies
- RPL37A (Ribosomal Protein L37a (RPL37A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPL37A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPL37 A antibody was raised against the middle region of RPL37
- Purification
- Affinity purified
- Immunogen
- RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD
- Top Product
- Discover our top product RPL37A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPL37A Blocking Peptide, catalog no. 33R-1703, is also available for use as a blocking control in assays to test for specificity of this RPL37A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL37A (Ribosomal Protein L37a (RPL37A))
- Alternative Name
- RPL37A (RPL37A Products)
- Synonyms
- L37A antibody, BcDNA:RE23595 antibody, BcDNA:RH41593 antibody, CG5827 antibody, DmL37a antibody, Dmel\\CG5827 antibody, M(2)25C antibody, M(2)S1 antibody, RpL37a antibody, l(2)25Cb antibody, CG9091 antibody, Dmel\\CG9091 antibody, RpL37 antibody, RpL37A antibody, RGD1561181 antibody, Rpl37a antibody, ribosomal protein L37a antibody, Ribosomal protein L37A antibody, ribosomal protein L37a L homeolog antibody, Ribosomal protein L37a antibody, ribosomal protein L37a, pseudogene 1 antibody, RPL37A antibody, Rpl37a antibody, RpL37A antibody, rpl37a.L antibody, RpL37a antibody, Rpl37a-ps1 antibody
- Background
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Molecular Weight
- 10 kDa (MW of target protein)
-