RPL13A antibody (Middle Region)
-
- Target See all RPL13A Antibodies
- RPL13A (Ribosomal Protein L13a (RPL13A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPL13A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPL13 A antibody was raised against the middle region of RPL13
- Purification
- Affinity purified
- Immunogen
- RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY
- Top Product
- Discover our top product RPL13A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPL13A Blocking Peptide, catalog no. 33R-3724, is also available for use as a blocking control in assays to test for specificity of this RPL13A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL13A (Ribosomal Protein L13a (RPL13A))
- Alternative Name
- RPL13A (RPL13A Products)
- Synonyms
- 1810026N22Rik antibody, Tstap198-7 antibody, tum-antigen antibody, L13A antibody, TSTA1 antibody, CG1475 antibody, Dmel\\CG1475 antibody, L13a2 antibody, M(3)83B antibody, Rp L13A antibody, anon-EST:Posey125 antibody, anon-EST:fe1A5 antibody, bs25f04.y1 antibody, cg1475 antibody, MGC54018 antibody, GB16111 antibody, hm:zehp0384 antibody, wu:fa95e06 antibody, wu:fb08g07 antibody, wu:fd05d08 antibody, DDBDRAFT_0217704 antibody, DDBDRAFT_0231192 antibody, DDB_0217704 antibody, DDB_0231192 antibody, ribosomal protein L13A antibody, ribosomal protein L13a antibody, Ribosomal protein L13A antibody, ribosomal protein L13a S homeolog antibody, 60S ribosomal protein L13a antibody, ribosomal protein 13a antibody, ribosomal 60S subunit protein L13A antibody, Ribosomal protein L13a, component of cytosolic 80S ribosome and 60S large subunit antibody, S60 ribosomal protein L13a antibody, Rpl13a antibody, RPL13A antibody, RpL13A antibody, rpl13a.S antibody, rpl13a antibody, LOC551418 antibody, LOC663151 antibody, RPL13a antibody
- Background
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Molecular Weight
- 22 kDa (MW of target protein)
-