RNF6 antibody
-
- Target See all RNF6 Antibodies
- RNF6 (RING Finger Protein 6 (RNF6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSE
- Top Product
- Discover our top product RNF6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF6 Blocking Peptide, catalog no. 33R-9514, is also available for use as a blocking control in assays to test for specificity of this RNF6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF6 (RING Finger Protein 6 (RNF6))
- Alternative Name
- RNF6 (RNF6 Products)
- Synonyms
- 1200013I08Rik antibody, 5730419H05Rik antibody, AA537053 antibody, ring finger protein 6 antibody, ring finger protein (C3H2C3 type) 6 antibody, RNF6 antibody, Rnf6 antibody
- Background
- RNF6 contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation.
- Molecular Weight
- 78 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Cell Size
-