Nanog antibody (N-Term)
-
- Target See all Nanog (NANOG) Antibodies
- Nanog (NANOG) (Nanog Homeobox (NANOG))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Nanog antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Nanog antibody was raised against the N terminal of NANOG
- Purification
- Affinity purified
- Immunogen
- Nanog antibody was raised using the N terminal of NANOG corresponding to a region with amino acids ESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDLLIQDSPDSST
- Top Product
- Discover our top product NANOG Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Nanog Blocking Peptide, catalog no. 33R-2746, is also available for use as a blocking control in assays to test for specificity of this Nanog antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NANOG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium Azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nanog (NANOG) (Nanog Homeobox (NANOG))
- Alternative Name
- Nanog (NANOG Products)
- Synonyms
- 2410002E02Rik antibody, ENK antibody, ecat4 antibody, NANOG antibody, hacp antibody, wu:fd19e04 antibody, wu:fd20a07 antibody, zgc:193933 antibody, Nanog homeobox antibody, nanog homeobox antibody, Nanog antibody, NANOG antibody, nanog antibody
- Background
- NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockDaown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-