TSKS antibody (Middle Region)
-
- Target See all TSKS Antibodies
- TSKS (Testis-Specific serine Kinase Substrate (TSKS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSKS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TSKS antibody was raised against the middle region of TSKS
- Purification
- Affinity purified
- Immunogen
- TSKS antibody was raised using the middle region of TSKS corresponding to a region with amino acids ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS
- Top Product
- Discover our top product TSKS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TSKS Blocking Peptide, catalog no. 33R-1367, is also available for use as a blocking control in assays to test for specificity of this TSKS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSKS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSKS (Testis-Specific serine Kinase Substrate (TSKS))
- Alternative Name
- TSKS (TSKS Products)
- Synonyms
- TSKS antibody, STK22S1 antibody, TSKS1 antibody, TSSKS antibody, Stk22s1 antibody, Tssks1 antibody, testis specific serine kinase substrate antibody, testis-specific serine kinase substrate antibody, TSKS antibody, Tsks antibody
- Background
- TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the TSKS is highest in the testis and down-regulated in testicular cancer. The gene encoded TSKS is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Toll-Like Receptors Cascades
-