SUMO3 antibody

Catalog No. ABIN631719

The Rabbit Polyclonal anti-SUMO3 antibody (ABIN631719) specifically detects SUMO3 in WB. The antibody is reactive with Human samples.

Quick Overview for SUMO3 antibody (ABIN631719)

Target: SUMO3 (Small Ubiquitin Related Modifier 3 (SUMO3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUMO3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SUMO3 Antibody

Purification: Affinity purified

Immunogen: SUMO3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SUMO3 Blocking Peptide, (ABIN5616458), is also available for use as a blocking control in assays to test for specificity of this SUMO3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUMO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUMO3

Target: SUMO3 (Small Ubiquitin Related Modifier 3 (SUMO3))

Alternative Name: SUMO3

Background: SUMO proteins, such as SUMO3, and ubiquitin posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.

Molecular Weight: 12 kDa (MW of target protein)