RAB3IL1 antibody
-
- Target See all RAB3IL1 Antibodies
- RAB3IL1 (RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAB3IL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RAB3 IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH
- Top Product
- Discover our top product RAB3IL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAB3IL1 Blocking Peptide, catalog no. 33R-1472, is also available for use as a blocking control in assays to test for specificity of this RAB3IL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 L1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB3IL1 (RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1))
- Alternative Name
- RAB3IL1 (RAB3IL1 Products)
- Synonyms
- GRAB antibody, 1200014K04Rik antibody, AI115013 antibody, C76746 antibody, Rab3ail1 antibody, Grab antibody, RAB3A interacting protein like 1 antibody, RAB3A interacting protein (rabin3)-like 1 antibody, RAB3A interacting protein-like 1 antibody, RAB3IL1 antibody, Rab3il1 antibody
- Background
- RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.
- Molecular Weight
- 43 kDa (MW of target protein)
-