TSR1 antibody
-
- Target See all TSR1 Antibodies
- TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV
- Top Product
- Discover our top product TSR1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TSR1 Blocking Peptide, catalog no. 33R-5698, is also available for use as a blocking control in assays to test for specificity of this TSR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))
- Alternative Name
- TSR1 (TSR1 Products)
- Synonyms
- AU040765 antibody, AW550801 antibody, mKIAA1401 antibody, TSR1 20S rRNA accumulation antibody, TSR1, ribosome maturation factor L homeolog antibody, TSR1, ribosome maturation factor antibody, Tsr1 antibody, tsr1.L antibody, TSR1 antibody
- Background
- TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.
- Molecular Weight
- 92 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-