RNASE9 antibody
-
- Target See all RNASE9 Antibodies
- RNASE9 (Ribonuclease, RNase A Family, 9 (Non-Active) (RNASE9))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNASE9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RNASE9 antibody was raised using a synthetic peptide corresponding to a region with amino acids PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH
- Top Product
- Discover our top product RNASE9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNASE9 Blocking Peptide, catalog no. 33R-7036, is also available for use as a blocking control in assays to test for specificity of this RNASE9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASE9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNASE9 (Ribonuclease, RNase A Family, 9 (Non-Active) (RNASE9))
- Alternative Name
- RNASE9 (RNASE9 Products)
- Synonyms
- HEL128 antibody, h461 antibody, ESRL antibody, ribonuclease A family member 9 (inactive) antibody, ribonuclease, RNase A family, 9 (non-active) antibody, RNASE9 antibody, Rnase9 antibody
- Background
- RNASE9 belongs to the pancreatic ribonuclease family. It may be involved in host defense.
- Molecular Weight
- 24 kDa (MW of target protein)
-