HEXDC antibody
-
- Target See all HEXDC Antibodies
- HEXDC (Hexosaminidase D (HEXDC))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HEXDC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HEXDC antibody was raised using a synthetic peptide corresponding to a region with amino acids CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA
- Top Product
- Discover our top product HEXDC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HEXDC Blocking Peptide, catalog no. 33R-1784, is also available for use as a blocking control in assays to test for specificity of this HEXDC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEXDC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HEXDC (Hexosaminidase D (HEXDC))
- Alternative Name
- HEXDC (HEXDC Products)
- Synonyms
- BC069960 antibody, fj33c04 antibody, wu:fj33c04 antibody, zgc:152869 antibody, hexdc antibody, hexosaminidase D antibody, hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing antibody, hexosaminidase D L homeolog antibody, HEXDC antibody, Hexdc antibody, hexdc antibody, hexdc.L antibody
- Background
- HEXDC has hexosaminidase activity.
- Molecular Weight
- 63 kDa (MW of target protein)
-