RPL10A antibody (Middle Region)
-
- Target See all RPL10A Antibodies
- RPL10A (Ribosomal Protein L10a (RPL10A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPL10A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPL10 A antibody was raised against the middle region of RPL10
- Purification
- Affinity purified
- Immunogen
- RPL10 A antibody was raised using the middle region of RPL10 corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK
- Top Product
- Discover our top product RPL10A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPL10A Blocking Peptide, catalog no. 33R-10063, is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL10A (Ribosomal Protein L10a (RPL10A))
- Alternative Name
- RPL10A (RPL10A Products)
- Synonyms
- Csa-19 antibody, L10A antibody, NEDD6 antibody, CsA-19 antibody, Nedd6 antibody, wu:fb94f08 antibody, zgc:73082 antibody, zgc:86881 antibody, ribosomal protein L10a antibody, ribosomal protein L10A antibody, ribosomal protein L10a S homeolog antibody, RPL10A antibody, Rpl10a antibody, rpl10a antibody, rpl10a.S antibody
- Background
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm.
- Molecular Weight
- 25 kDa (MW of target protein)
-