ALDH1B1 antibody (Middle Region)
-
- Target See all ALDH1B1 Antibodies
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALDH1B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ALDH1 B1 antibody was raised against the middle region of ALDH1 1
- Purification
- Affinity purified
- Immunogen
- ALDH1 B1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
- Top Product
- Discover our top product ALDH1B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALDH1B1 Blocking Peptide, catalog no. 33R-3255, is also available for use as a blocking control in assays to test for specificity of this ALDH1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
- Alternative Name
- ALDH1B1 (ALDH1B1 Products)
- Synonyms
- ALDH5 antibody, ALDHX antibody, rf2d antibody, 2700007F14Rik antibody, aldehyde dehydrogenase 1 family member B1 antibody, aldehyde dehydrogenase 5 antibody, aldehyde dehydrogenase 1 family, member B1 antibody, aldehyde dehydrogenase 3B1 antibody, hypothetical protein antibody, ALDH1B1 antibody, aldh5 antibody, Aldh1b1 antibody, MCYG_01035 antibody, MGYG_00956 antibody, PGTG_20239 antibody
- Background
- ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
- Molecular Weight
- 57 kDa (MW of target protein)
-