CPN2 antibody (N-Term)
-
- Target See all CPN2 Antibodies
- CPN2 (Carboxypeptidase N Subunit 2 (CPN2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Carboxypeptidase N2 antibody was raised against the N terminal of CPN2
- Purification
- Affinity purified
- Immunogen
- Carboxypeptidase N2 antibody was raised using the N terminal of CPN2 corresponding to a region with amino acids FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL
- Top Product
- Discover our top product CPN2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carboxypeptidase N2 Blocking Peptide, catalog no. 33R-3103, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPN2 (Carboxypeptidase N Subunit 2 (CPN2))
- Alternative Name
- Carboxypeptidase N2 (CPN2 Products)
- Synonyms
- cpn2 antibody, im:7138819 antibody, Cpn2 antibody, GB13055 antibody, DKFZp470I1612 antibody, ACBP antibody, 1300018K11Rik antibody, RGD1305170 antibody, carboxypeptidase N subunit 2 antibody, zgc:153913 antibody, carboxypeptidase N, polypeptide 2 antibody, CPN2 antibody, zgc:153913 antibody, Cpn2 antibody, CpipJ_CPIJ008561 antibody, CpipJ_CPIJ010495 antibody, CpipJ_CPIJ013628 antibody
- Background
- CPN2 contains 13 LRR (leucine-rich) repeats. The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.
- Molecular Weight
- 60 kDa (MW of target protein)
-