ACTRT1 antibody (Middle Region)
-
- Target See all ACTRT1 Antibodies
- ACTRT1 (Actin-Related Protein T1 (ACTRT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACTRT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACTRT1 antibody was raised against the middle region of ACTRT1
- Purification
- Affinity purified
- Immunogen
- ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
- Top Product
- Discover our top product ACTRT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACTRT1 Blocking Peptide, catalog no. 33R-2189, is also available for use as a blocking control in assays to test for specificity of this ACTRT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTRT1 (Actin-Related Protein T1 (ACTRT1))
- Alternative Name
- ACTRT1 (ACTRT1 Products)
- Synonyms
- 1700061J02Rik antibody, Arp-T1 antibody, AIP1 antibody, ARIP1 antibody, ARPT1 antibody, HSD27 antibody, ACTRT1 antibody, actin-related protein T1 antibody, actin related protein T1 antibody, Actrt1 antibody, ACTRT1 antibody, LOC539271 antibody, LOC100344945 antibody, LOC100455523 antibody, LOC100472383 antibody, LOC100154405 antibody
- Background
- The specific function of ACTRT1 is not yet known.
- Molecular Weight
- 42 kDa (MW of target protein)
-