TMEM184A antibody (C-Term)
-
- Target See all TMEM184A products
- TMEM184A (Transmembrane Protein 184A (TMEM184A))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM184A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM184 A antibody was raised against the C terminal of TMEM184
- Purification
- Affinity purified
- Immunogen
- TMEM184 A antibody was raised using the C terminal of TMEM184 corresponding to a region with amino acids CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM184A Blocking Peptide, catalog no. 33R-1788, is also available for use as a blocking control in assays to test for specificity of this TMEM184A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM180 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM184A (Transmembrane Protein 184A (TMEM184A))
- Alternative Name
- TMEM184A (TMEM184A Products)
- Synonyms
- RGD1306702 antibody, Sdmg1 antibody, transmembrane protein 184A antibody, Transmembrane protein 184A antibody, transmembrane protein 184a antibody, EDI_093830 antibody, t184a antibody, TMEM184A antibody, Tmem184a antibody
- Background
- TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.
- Molecular Weight
- 46 kDa (MW of target protein)
-