PARP12 antibody

Catalog No. ABIN631944

Product Details anti-PARP12 Antibody

Target: PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP12 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARP12 Blocking Peptide, catalog no. 33R-3134, is also available for use as a blocking control in assays to test for specificity of this PARP12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP12

Target: PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))

Alternative Name: PARP12 (PARP12 Products)

Synonyms: ARTD12 antibody, MST109 antibody, MSTP109 antibody, ZC3H1 antibody, ZC3HDC1 antibody, 9930021O16 antibody, AA409132 antibody, AA536654 antibody, PARP-12 antibody, Zc3hdc1 antibody, PARP12 antibody, zc3h1 antibody, mst109 antibody, mstp109 antibody, zc3hdc1 antibody, si:ch211-227d19.2 antibody, poly(ADP-ribose) polymerase family member 12 antibody, poly (ADP-ribose) polymerase family, member 12 antibody, poly(ADP-ribose) polymerase family member 12 L homeolog antibody, poly (ADP-ribose) polymerase family, member 12a antibody, poly [ADP-ribose] polymerase 12 antibody, PARP12 antibody, Parp12 antibody, parp12.L antibody, parp12a antibody, parp12 antibody, LOC100561568 antibody

Background: The function of PARP12 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 79 kDa (MW of target protein)