ASCC2 antibody (Middle Region)
-
- Target See all ASCC2 Antibodies
- ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASCC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ASCC2 antibody was raised against the middle region of ASCC2
- Purification
- Affinity purified
- Immunogen
- ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD
- Top Product
- Discover our top product ASCC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASCC2 Blocking Peptide, catalog no. 33R-10082, is also available for use as a blocking control in assays to test for specificity of this ASCC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASCC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))
- Alternative Name
- ASCC2 (ASCC2 Products)
- Synonyms
- MGC63666 antibody, zgc:63666 antibody, ASCC2 antibody, ascc2 antibody, asc1p100 antibody, ASC1p100 antibody, p100 antibody, 1700011I11Rik antibody, 2610034L15Rik antibody, AI482016 antibody, AW046480 antibody, RGD1561422 antibody, activating signal cointegrator 1 complex subunit 2 antibody, activating signal cointegrator 1 complex subunit 2 S homeolog antibody, ascc2 antibody, ASCC2 antibody, MCYG_08331 antibody, ascc2.S antibody, Ascc2 antibody
- Background
- ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.
- Molecular Weight
- 86 kDa (MW of target protein)
-