PLS1 antibody
-
- Target See all PLS1 Antibodies
- PLS1 (Plastin 1 (PLS1))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Plastin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
- Top Product
- Discover our top product PLS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Plastin 1 Blocking Peptide, catalog no. 33R-4152, is also available for use as a blocking control in assays to test for specificity of this Plastin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLS1 (Plastin 1 (PLS1))
- Alternative Name
- Plastin 1 (PLS1 Products)
- Synonyms
- i-plastin antibody, DKFZp459F2151 antibody, Plastin-1 antibody, wu:fi38g03 antibody, zgc:63494 antibody, AI427122 antibody, plastin 1 antibody, plastin 1 (I isoform) antibody, plastin 1 (I-isoform) antibody, PLS1 antibody, pls1 antibody, Pls1 antibody
- Background
- Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.
- Molecular Weight
- 70 kDa (MW of target protein)
-