Calpain S1 antibody (Middle Region)

Catalog No. ABIN632073

The Rabbit Polyclonal anti-Calpain S1 antibody (ABIN632073) specifically detects Calpain S1 in WB. The antibody is reactive with Human samples.

Quick Overview for Calpain S1 antibody (Middle Region) (ABIN632073)

Target: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calpain S1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Calpain S1 Antibody

Binding Specificity: Middle Region

Specificity: Calpain 4 antibody was raised against the middle region of CAPNS1

Purification: Affinity purified

Immunogen: Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calpain 4 Blocking Peptide, (ABIN5612585), is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPNS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calpain S1

Target: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Alternative Name: Calpain 4

Background: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Apoptosis