Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Calpain S1 antibody (Calpain, Small Subunit 1) (AA 172-260) Primary Antibody

CAPNS1 Reactivity: Human IF, IHC (p), RNAi, ELISA, WB Host: Mouse Monoclonal 3C4 unconjugated
Pubmed (3)
Catalog No. ABIN560162
$524.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Calpain S1 (CAPNS1)
    Binding Specificity
    • 7
    • 2
    • 2
    • 2
    • 1
    • 1
    AA 172-260
    Reactivity
    • 35
    • 20
    • 12
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 30
    • 5
    Mouse
    Clonality
    • 31
    • 4
    Monoclonal
    Conjugate
    • 18
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    This Calpain S1 antibody is un-conjugated
    Application
    • 19
    • 12
    • 10
    • 5
    • 4
    • 2
    • 2
    • 1
    • 1
    Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), RNA Interference (RNAi), ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant CAPNS1.
    Cross-Reactivity
    Human, Rat (Rattus)
    Immunogen

    immunogen: CAPNS1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE

    Clone
    3C4
    Isotype
    IgG1 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Iguchi-Hashimoto, Usui, Yoshifuji, Shimizu, Kobayashi, Ito, Murakami, Shiomi, Yukawa, Kawabata, Nojima, Ohmura, Fujii, Mimori: "Overexpression of a minimal domain of calpastatin suppresses IL-6 production and Th17 development via reduced NF-?B and increased STAT5 signals." in: PLoS ONE, Vol. 6, Issue 10, pp. e27020, 2011 (PubMed).

    Tabata, Tabata, Nakano: "The calpain inhibitor calpeptin prevents bleomycin-induced pulmonary fibrosis in mice." in: Clinical and experimental immunology, Vol. 162, Issue 3, pp. 560-7, 2010 (PubMed).

    Barker, Leonard, Hansen, Trawick, Ingram, Burdett, Lebold, Walker, Traber: "Vitamin E and C supplementation does not ameliorate muscle dysfunction after anterior cruciate ligament surgery." in: Free radical biology & medicine, Vol. 47, Issue 11, pp. 1611-8, 2009 (PubMed).

  • Target
    Calpain S1 (CAPNS1)
    Alternative Name
    CAPNS1 (CAPNS1 Antibody Abstract)
    Synonyms
    30K, CALPAIN4, CANP, CANPS, CAPN4, CDPS, CSS1, Capn4, CAPNS1, Capa-4, Capa4, D7Ertd146e, MGC84330, capns1, cb616, wu:fb81g08, wu:fl09e04, zgc:110603, calpain small subunit 1, calpain, small subunit 1, calpain, small subunit 1 L homeolog, calpain, small subunit 1 a, CAPNS1, Capns1, capns1.L, capns1a
    Background
    Full Gene Name: calpain, small subunit 1
    Synonyms: 30K,CALPAIN4,CANP,CANPS,CAPN4,CDPS
    Gene ID
    826
    Pathways
    Apoptosis
You are here:
help Support