FAM54A antibody (Middle Region)
-
- Target See all FAM54A Antibodies
- FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM54A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM54 A antibody was raised against the middle region of FAM54
- Purification
- Affinity purified
- Immunogen
- FAM54 A antibody was raised using the middle region of FAM54 corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ
- Top Product
- Discover our top product FAM54A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM54A Blocking Peptide, catalog no. 33R-6748, is also available for use as a blocking control in assays to test for specificity of this FAM54A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))
- Alternative Name
- FAM54A (FAM54A Products)
- Synonyms
- FAM54A antibody, DUFD1 antibody, 2610016C23Rik antibody, 4933412C16Rik antibody, Dufd1 antibody, Fam54a antibody, mitochondrial fission regulator 2 antibody, MTFR2 antibody, Mtfr2 antibody
- Background
- FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.
- Molecular Weight
- 43 kDa (MW of target protein)
-