Septin 9 antibody (Middle Region)
-
- Target See all Septin 9 (SEPT9) Antibodies
- Septin 9 (SEPT9)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Septin 9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Septin 9 antibody was raised against the middle region of SEPT9
- Purification
- Affinity purified
- Immunogen
- Septin 9 antibody was raised using the middle region of SEPT9 corresponding to a region with amino acids VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL
- Top Product
- Discover our top product SEPT9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Septin 9 Blocking Peptide, catalog no. 33R-9702, is also available for use as a blocking control in assays to test for specificity of this Septin 9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Septin 9 (SEPT9)
- Alternative Name
- Septin 9 (SEPT9 Products)
- Synonyms
- SEPT9 antibody, msf antibody, msf1 antibody, napb antibody, sint1 antibody, pnutl4 antibody, septd1 antibody, af17q25 antibody, septin-9 antibody, AF17q25 antibody, MSF antibody, MSF1 antibody, NAPB antibody, PNUTL4 antibody, SINT1 antibody, SeptD1 antibody, Msf antibody, Sint1 antibody, Eseptin antibody, Slpa antibody, cb999 antibody, fb02h06 antibody, sept9 antibody, wu:fb02h06 antibody, septin 9 antibody, septin-9 antibody, septin 9 S homeolog antibody, septin 9a antibody, SEPT9 antibody, sept9 antibody, LOC100605286 antibody, sept9.S antibody, Sept9 antibody, sept9a antibody
- Background
- This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.
- Molecular Weight
- 46 kDa (MW of target protein)
-