EPRS antibody (Middle Region)
-
- Target See all EPRS Antibodies
- EPRS (Glutamyl-Prolyl-tRNA Synthetase (EPRS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EPRS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EPRS antibody was raised against the middle region of EPRS
- Purification
- Affinity purified
- Immunogen
- EPRS antibody was raised using the middle region of EPRS corresponding to a region with amino acids GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL
- Top Product
- Discover our top product EPRS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EPRS Blocking Peptide, catalog no. 33R-3367, is also available for use as a blocking control in assays to test for specificity of this EPRS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPRS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPRS (Glutamyl-Prolyl-tRNA Synthetase (EPRS))
- Alternative Name
- EPRS (EPRS Products)
- Synonyms
- EARS antibody, GLUPRORS antibody, PARS antibody, QARS antibody, QPRS antibody, wu:fb38d08 antibody, wu:ft34d10 antibody, 2410081F06Rik antibody, 3010002K18Rik antibody, C79379 antibody, Qprs antibody, glutamyl-prolyl-tRNA synthetase antibody, glutamyl-prolyl-tRNA synthetase S homeolog antibody, EPRS antibody, eprs antibody, eprs.S antibody, Eprs antibody
- Background
- The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.
- Molecular Weight
- 170 kDa (MW of target protein)
-