SFRP2 antibody (Middle Region)

Catalog No. ABIN632136

Product Details anti-SFRP2 Antibody

Target: SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SFRP2 antibody was raised against the middle region of SFRP2

Purification: Affinity purified

Immunogen: SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRP2 Blocking Peptide, catalog no. 33R-2142, is also available for use as a blocking control in assays to test for specificity of this SFRP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRP2

Target: SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))

Alternative Name: SFRP2 (SFRP2 Products)

Synonyms: frp-2 antibody, sarp1 antibody, sdf-5 antibody, sfrp-2 antibody, SFRP2 antibody, sfrp2 antibody, FRP-2 antibody, SARP1 antibody, SDF-5 antibody, AI851596 antibody, Sdf5 antibody, hm:zeh0225 antibody, zeh0225 antibody, zgc:153618 antibody, SFRP-2 antibody, secreted frizzled-related protein 2 antibody, secreted frizzled related protein 2 antibody, secreted frizzled-related protein 2 S homeolog antibody, secreted frizzled-related protein antibody, sfrp2 antibody, sfrp2 antibody, SFRP2 antibody, sfrp2.S antibody, LOAG_01461 antibody, Sfrp2 antibody

Background: SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: WNT Signaling, Tube Formation, Positive Regulation of Endopeptidase Activity, Negative Regulation of intrinsic apoptotic Signaling, Positive Regulation of fat Cell Differentiation