PDXK antibody

Catalog No. ABIN632138

Product Details anti-PDXK Antibody

Target: PDXK (Pyridoxal Kinase (PDXK))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDXK antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDXK Blocking Peptide, catalog no. 33R-7204, is also available for use as a blocking control in assays to test for specificity of this PDXK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDXK

Target: PDXK (Pyridoxal Kinase (PDXK))

Alternative Name: PDXK (PDXK Products)

Synonyms: C21orf124 antibody, C21orf97 antibody, PKH antibody, PNK antibody, 2310036D04Rik antibody, AA119688 antibody, C77999 antibody, Pdxk antibody, PSPTO5521 antibody, DDBDRAFT_0190079 antibody, DDBDRAFT_0191114 antibody, DDB_0190079 antibody, DDB_0191114 antibody, ATSOS4 antibody, K18L3.1 antibody, K18L3_1 antibody, SALT OVERLY SENSITIVE 4 antibody, pdxk antibody, si:dkey-263m10.2 antibody, si:dz69g10.1 antibody, cb1056 antibody, pdxkl antibody, si:dkey-281i8.2 antibody, wu:fa55a03 antibody, wu:fb10c12 antibody, zgc:101900 antibody, pyridoxal kinase antibody, pyridoxal (pyridoxine, vitamin B6) kinase antibody, Pyridoxal kinase antibody, pfkB-like carbohydrate kinase family protein antibody, pyridoxal (pyridoxine, vitamin B6) kinase b antibody, pyridoxal (pyridoxine, vitamin B6) kinase a antibody, PDXK antibody, Pdxk antibody, pdxY antibody, pdxK antibody, Bphyt_1541 antibody, pykA antibody, Kfla_4736 antibody, Kvar_1290 antibody, Mrub_2507 antibody, BC1002_1103 antibody, Fbal_1661 antibody, Lbys_0710 antibody, Intca_0131 antibody, Deima_3190 antibody, Mesop_1158 antibody, LOC100283562 antibody, pdxk antibody, SOS4 antibody, pdxkb antibody, pdxka antibody

Background: PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer.

Molecular Weight: 34 kDa (MW of target protein)