VPS54 antibody
-
- Target See all VPS54 Antibodies
- VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VPS54 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR
- Top Product
- Discover our top product VPS54 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VPS54 Blocking Peptide, catalog no. 33R-3139, is also available for use as a blocking control in assays to test for specificity of this VPS54 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS54 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))
- Alternative Name
- VPS54 (VPS54 Products)
- Synonyms
- 5330404P15Rik antibody, Hcc8 antibody, Vps54l antibody, mSLP8 antibody, wr antibody, HCC8 antibody, SLP-8p antibody, VPS54L antibody, WR antibody, hVps54L antibody, Vsp54 antibody, Vacuolar protein sorting-associated protein 54 antibody, VPS54 GARP complex subunit antibody, VPS54, GARP complex subunit antibody, vps-54 antibody, Vps54 antibody, VPS54 antibody
- Background
- VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi.
- Molecular Weight
- 107 kDa (MW of target protein)
-