PRKAB1 antibody (N-Term)

Catalog No. ABIN632268

Product Details anti-PRKAB1 Antibody

Target: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKAB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKAB1 antibody was raised against the N terminal of PRKAB1

Purification: Affinity purified

Immunogen: PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKAB1 Blocking Peptide, catalog no. 33R-4439, is also available for use as a blocking control in assays to test for specificity of this PRKAB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKAB1

Target: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Alternative Name: PRKAB1 (PRKAB1 Products)

Synonyms: AMPK antibody, HAMPKb antibody, 1300015D22Rik antibody, AU021155 antibody, E430008F22 antibody, MGC82489 antibody, prkab1 antibody, wu:fk93d05 antibody, wu:fw87e09 antibody, zgc:56652 antibody, zgc:76975 antibody, zgc:92228 antibody, protein kinase AMP-activated non-catalytic subunit beta 1 antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit, b antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit, a antibody, PRKAB1 antibody, Prkab1 antibody, prkab1.S antibody, prkab1 antibody, prkab1b antibody, prkab1a antibody

Background: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Molecular Weight: 30 kDa (MW of target protein)

Pathways: AMPK Signaling, Warburg Effect