RGS10 antibody (Middle Region)

Catalog No. ABIN632272

Product Details anti-RGS10 Antibody

Target: RGS10 (Regulator of G-Protein Signaling 10 (RGS10))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RGS10 antibody was raised against the middle region of RGS10

Purification: Affinity purified

Immunogen: RGS10 antibody was raised using the middle region of RGS10 corresponding to a region with amino acids DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Application Details

Application Notes: WB: 0.2 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS10

Target: RGS10 (Regulator of G-Protein Signaling 10 (RGS10))

Alternative Name: RGS10 (RGS10 Products)

Synonyms: MGC82511 antibody, RGS10 antibody, 2310010N19Rik antibody, regulator of G-protein signaling 10 antibody, regulator of G-protein signaling 10 L homeolog antibody, regulator of G protein signaling 10 antibody, regulator of G-protein signalling 10 antibody, RGS10 antibody, rgs10.L antibody, rgs10 antibody, Rgs10 antibody

Background: RGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling