PPME1 antibody (N-Term)
-
- Target See all PPME1 Antibodies
- PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPME1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPME1 antibody was raised against the N terminal of PPME1
- Purification
- Affinity purified
- Immunogen
- PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids PGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHG
- Top Product
- Discover our top product PPME1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPME1 Blocking Peptide, catalog no. 33R-7126, is also available for use as a blocking control in assays to test for specificity of this PPME1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPME1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))
- Alternative Name
- PPME1 (PPME1 Products)
- Synonyms
- PME-1 antibody, 1110069N17Rik antibody, 2700017M01Rik antibody, Pme1 antibody, fk72d03 antibody, zgc:56239 antibody, wu:fk72d03 antibody, RGD1309683 antibody, PME1MGC133824 antibody, F28M11.4 antibody, DDBDRAFT_0204584 antibody, DDBDRAFT_0305014 antibody, DDB_0204584 antibody, DDB_0305014 antibody, PME1 antibody, CaO19.1459 antibody, protein phosphatase methylesterase 1 antibody, protein phosphatase methylesterase 1 S homeolog antibody, esterase/lipase/thioesterase family protein antibody, carboxylesterase-mitochondrial 37S ribosomal protein YmS2 antibody, PPME1 antibody, Ppme1 antibody, ppme1 antibody, ppme1.S antibody, AT4G10050 antibody, PPE1 antibody
- Background
- Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-