CDRT4 antibody (Middle Region)
-
- Target See all CDRT4 products
- CDRT4 (CMT1A Duplicated Region Transcript 4 (CDRT4))
-
Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDRT4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CDRT4 antibody was raised against the middle region of CDRT4
- Purification
- Affinity purified
- Immunogen
- CDRT4 antibody was raised using the middle region of CDRT4 corresponding to a region with amino acids TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDRT4 Blocking Peptide, catalog no. 33R-9293, is also available for use as a blocking control in assays to test for specificity of this CDRT4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDRT4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDRT4 (CMT1A Duplicated Region Transcript 4 (CDRT4))
- Alternative Name
- CDRT4 (CDRT4 Products)
- Synonyms
- 1700019I23Rik antibody, CMT1A duplicated region transcript 4 antibody, CDRT4 antibody, Cdrt4 antibody
- Background
- The specific function of CDRT4 is not yet known.
- Molecular Weight
- 17 kDa (MW of target protein)
-