PPIH antibody
-
- Target See all PPIH Antibodies
- PPIH (Peptidylprolyl Isomerase H (Cyclophilin H) (PPIH))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPIH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPIH antibody was raised using a synthetic peptide corresponding to a region with amino acids DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
- Top Product
- Discover our top product PPIH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPIH Blocking Peptide, catalog no. 33R-1933, is also available for use as a blocking control in assays to test for specificity of this PPIH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIH (Peptidylprolyl Isomerase H (Cyclophilin H) (PPIH))
- Alternative Name
- PPIH (PPIH Products)
- Synonyms
- CYP-20 antibody, CYPH antibody, SnuCyp-20 antibody, USA-CYP antibody, RGD1564921 antibody, cyp-20 antibody, cyph antibody, snucyp-20 antibody, usa-cyp antibody, PPIH antibody, zgc:136730 antibody, zgc:158595 antibody, zgc:55766 antibody, zgc:86780 antibody, 1100001J08Rik antibody, 2010111B15Rik antibody, 4833408F11Rik antibody, AI464484 antibody, D4Wsu43e antibody, peptidylprolyl isomerase H antibody, peptidylprolyl isomerase H (cyclophilin H) antibody, peptidylprolyl isomerase H L homeolog antibody, peptidyl prolyl isomerase H antibody, PPIH antibody, Ppih antibody, ppih antibody, ppih.L antibody
- Background
- The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
- Molecular Weight
- 19 kDa (MW of target protein)
-