PDP2 antibody (Middle Region)
-
- Target See all PDP2 Antibodies
- PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PDP2 antibody was raised against the middle region of PDP2
- Purification
- Affinity purified
- Immunogen
- PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV
- Top Product
- Discover our top product PDP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDP2 Blocking Peptide, catalog no. 33R-5337, is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))
- Alternative Name
- PDP2 (PDP2 Products)
- Synonyms
- PDP2 antibody, DKFZp459I1928 antibody, 4833426J09Rik antibody, Gm1705 antibody, mKIAA1348 antibody, PPM2C2 antibody, pyruvate dehyrogenase phosphatase catalytic subunit 2 antibody, PDP2 antibody, pdp2 antibody, Pdp2 antibody
- Background
- PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
- Molecular Weight
- 60 kDa (MW of target protein)
-