Caldesmon antibody (Middle Region)
-
- Target See all Caldesmon (CALD1) Antibodies
- Caldesmon (CALD1) (Caldesmon 1 (CALD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Caldesmon antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Caldesmon 1 antibody was raised against the middle region of CALD1
- Purification
- Affinity purified
- Immunogen
- Caldesmon 1 antibody was raised using the middle region of CALD1 corresponding to a region with amino acids FSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGD
- Top Product
- Discover our top product CALD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Caldesmon 1 Blocking Peptide, catalog no. 33R-3075, is also available for use as a blocking control in assays to test for specificity of this Caldesmon 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Caldesmon (CALD1) (Caldesmon 1 (CALD1))
- Alternative Name
- Caldesmon 1 (CALD1 Products)
- Synonyms
- CDM antibody, H-CAD antibody, HCAD antibody, L-CAD antibody, LCAD antibody, NAG22 antibody, l-Cad antibody, 4833423D12Rik antibody, AI195384 antibody, AV071549 antibody, AW536160 antibody, C920027I18Rik antibody, CALD1 antibody, Caldesmon antibody, caldesmon 1 antibody, CALD1 antibody, Cald1 antibody
- Background
- CALD1 is a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction.
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction
-