CDCA7L antibody (Middle Region)

Catalog No. ABIN632453

Product Details anti-CDCA7L Antibody

Target: CDCA7L (Cell Division Cycle Associated 7-Like (CDCA7L))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDCA7L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDCA7 L antibody was raised against the middle region of CDCA7

Purification: Affinity purified

Immunogen: CDCA7 L antibody was raised using the middle region of CDCA7 corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDCA7L Blocking Peptide, catalog no. 33R-7245, is also available for use as a blocking control in assays to test for specificity of this CDCA7L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDCA7L

Target: CDCA7L (Cell Division Cycle Associated 7-Like (CDCA7L))

Alternative Name: CDCA7L (CDCA7L Products)

Synonyms: ram2 antibody, MGC154777 antibody, BC006933 antibody, JPO2 antibody, R1 antibody, RAM2 antibody, RAPGEF5 antibody, cell division cycle associated 7 like antibody, cell division cycle associated 7 like L homeolog antibody, cell division cycle-associated 7-like protein antibody, CDCA7L antibody, cdca7l.L antibody, LOC100454683 antibody, Cdca7l antibody

Background: CDCA7L plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. CDCA7L is involved in apoptotic signaling pathways. CDCA7L may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.

Molecular Weight: 46 kDa (MW of target protein)