LRRC2 antibody (N-Term)
-
- Target See all LRRC2 Antibodies
- LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC2 antibody was raised against the N terminal of LRRC2
- Purification
- Affinity purified
- Immunogen
- LRRC2 antibody was raised using the N terminal of LRRC2 corresponding to a region with amino acids GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA
- Top Product
- Discover our top product LRRC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC2 Blocking Peptide, catalog no. 33R-3309, is also available for use as a blocking control in assays to test for specificity of this LRRC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))
- Alternative Name
- LRRC2 (LRRC2 Products)
- Synonyms
- 2400002D05Rik antibody, 4933431K03Rik antibody, leucine rich repeat containing 2 antibody, LRRC2 antibody, Lrrc2 antibody
- Background
- Leucine-rich repeats (LRRs) are 20-29 amino acid motifs that mediate proteinprotein interactions. The primary function of these motifs is to provide a versatile structural framework for the formation of these protein-protein interactions.
- Molecular Weight
- 43 kDa (MW of target protein)
-