ACLY antibody (Middle Region)
-
- Target See all ACLY Antibodies
- ACLY (ATP Citrate Lyase (ACLY))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACLY antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACLY antibody was raised against the middle region of ACLY
- Purification
- Affinity purified
- Immunogen
- ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI
- Top Product
- Discover our top product ACLY Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACLY Blocking Peptide, catalog no. 33R-8779, is also available for use as a blocking control in assays to test for specificity of this ACLY antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACLY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACLY (ATP Citrate Lyase (ACLY))
- Alternative Name
- ACLY (ACLY Products)
- Synonyms
- ACLY antibody, DDBDRAFT_0205389 antibody, DDBDRAFT_0235360 antibody, DDB_0205389 antibody, DDB_0235360 antibody, ACL antibody, BcDNA:LD21334 antibody, CG8322 antibody, DmATPCL antibody, Dmel\\CG8322 antibody, anon-WO0140519.179 antibody, dATPCL antibody, l(2)01466 antibody, l(2)k09217 antibody, n(2)k09217 antibody, ATPCL antibody, CLATP antibody, A730098H14Rik antibody, AW538652 antibody, Clatp antibody, acly antibody, cb722 antibody, zgc:92008 antibody, ATP citrate lyase antibody, ATP citrate lyase S homeolog antibody, ATP-citrate synthase antibody, citrate synthase, mitochondrial antibody, atp-citrate synthase antibody, ATP citrate lyase a antibody, ACLY antibody, acly.S antibody, LOC587157 antibody, acly antibody, ATPCL antibody, LOC5564509 antibody, CpipJ_CPIJ010291 antibody, Bm1_26245 antibody, ACL antibody, Acly antibody, aclya antibody
- Background
- ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits.
- Molecular Weight
- 121 kDa (MW of target protein)
- Pathways
- Warburg Effect
-