DNAJC12 antibody
-
- Target See all DNAJC12 Antibodies
- DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DNAJC12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DNAJC12 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE
- Top Product
- Discover our top product DNAJC12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNAJC12 Blocking Peptide, catalog no. 33R-2668, is also available for use as a blocking control in assays to test for specificity of this DNAJC12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))
- Alternative Name
- DNAJC12 (DNAJC12 Products)
- Synonyms
- DNAJC12 antibody, JDP1 antibody, Jdp1 antibody, mJDP1 antibody, DnaJ heat shock protein family (Hsp40) member C12 antibody, DnaJ (Hsp40) homolog, subfamily C, member 12 antibody, DNAJC12 antibody, dnajc12 antibody, Dnajc12 antibody
- Background
- This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Molecular Weight
- 23 kDa (MW of target protein)
-