AGGF1 antibody (Middle Region)
-
- Target See all AGGF1 Antibodies
- AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AGGF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AGGF1 antibody was raised against the middle region of AGGF1
- Purification
- Affinity purified
- Immunogen
- AGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR
- Top Product
- Discover our top product AGGF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AGGF1 Blocking Peptide, catalog no. 33R-2818, is also available for use as a blocking control in assays to test for specificity of this AGGF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGGF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))
- Alternative Name
- AGGF1 (AGGF1 Products)
- Synonyms
- RGD1310888 antibody, AGGF1 antibody, LOC100037685 antibody, im:7146636 antibody, zgc:152959 antibody, DKFZp459G1317 antibody, GPATC7 antibody, GPATCH7 antibody, HSU84971 antibody, HUS84971 antibody, VG5Q antibody, 2010009L17Rik antibody, 2310029P06Rik antibody, AW112072 antibody, Peg3 antibody, angiogenic factor with G patch and FHA domains 1 antibody, angiogenic factor with G-patch and FHA domains 1 antibody, Aggf1 antibody, AGGF1 antibody, aggf1 antibody, CC1G_06398 antibody
- Background
- The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain.
- Molecular Weight
- 81 kDa (MW of target protein)
-