ARHGAP30 antibody (N-Term)

Catalog No. ABIN632572

Product Details anti-ARHGAP30 Antibody

Target: ARHGAP30 (rho GTPase Activating Protein 30 (ARHGAP30))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGAP30 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARHGAP30 antibody was raised against the N terminal of ARHGAP30

Purification: Affinity purified

Immunogen: ARHGAP30 antibody was raised using the N terminal of ARHGAP30 corresponding to a region with amino acids RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGAP30 Blocking Peptide, catalog no. 33R-8013, is also available for use as a blocking control in assays to test for specificity of this ARHGAP30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARHGAP30

Target: ARHGAP30 (rho GTPase Activating Protein 30 (ARHGAP30))

Alternative Name: ARHGAP30 (ARHGAP30 Products)

Synonyms: 6030405P05Rik antibody, Gm102 antibody, mFLJ00267 antibody, Rho GTPase activating protein 30 antibody, ARHGAP30 antibody, Arhgap30 antibody

Background: ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Molecular Weight: 98 kDa (MW of target protein)