DUS1L antibody
-
- Target See all DUS1L Antibodies
- DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DUS1L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DUS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF
- Top Product
- Discover our top product DUS1L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DUS1L Blocking Peptide, catalog no. 33R-2345, is also available for use as a blocking control in assays to test for specificity of this DUS1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUS0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))
- Alternative Name
- DUS1L (DUS1L Products)
- Synonyms
- zgc:63748 antibody, wu:fb71f06 antibody, DUS1 antibody, PP3111 antibody, 1110032N12Rik antibody, Dus1l antibody, x85 antibody, dihydrouridine synthase 1-like (S. cerevisiae) antibody, dihydrouridine synthase 1 like antibody, tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like antibody, dihydrouridine synthase 1-like (S. cerevisiae) pseudogene antibody, dihydrouridine synthase 1-like antibody, dus1l antibody, DUS1L antibody, LOC745178 antibody, LOC100408764 antibody, Dus1l antibody
- Background
- DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
- Molecular Weight
- 53 kDa (MW of target protein)
-