PDYN antibody (Middle Region)
-
- Target See all PDYN Antibodies
- PDYN (Prodynorphin (PDYN))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDYN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Prodynorphin antibody was raised against the middle region of PDYN
- Purification
- Affinity purified
- Immunogen
- Prodynorphin antibody was raised using the middle region of PDYN corresponding to a region with amino acids SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE
- Top Product
- Discover our top product PDYN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Prodynorphin Blocking Peptide, catalog no. 33R-8391, is also available for use as a blocking control in assays to test for specificity of this Prodynorphin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDYN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDYN (Prodynorphin (PDYN))
- Alternative Name
- Prodynorphin (PDYN Products)
- Synonyms
- pdyn antibody, ADCA antibody, PENKB antibody, SCA23 antibody, Dyn antibody, OLPB antibody, olpa antibody, XOLPA antibody, penkb antibody, Xen-dorphin antibody, olpb antibody, XOLPB antibody, wu:fj38c03 antibody, PDYN antibody, prodynorphin antibody, prodynorphin L homeolog antibody, prodynorphin S homeolog antibody, pdyn antibody, PDYN antibody, Pdyn antibody, pdyn.L antibody, pdyn.S antibody
- Background
- The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
- Molecular Weight
- 27 kDa (MW of target protein)
-