GART antibody (Middle Region)

Catalog No. ABIN632626

Product Details anti-GART Antibody

Target: GART (Phosphoribosylglycinamide Formyltransferase (GART))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GART antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GART antibody was raised against the middle region of GART

Purification: Affinity purified

Immunogen: GART antibody was raised using the middle region of GART corresponding to a region with amino acids VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GART Blocking Peptide, catalog no. 33R-9669, is also available for use as a blocking control in assays to test for specificity of this GART antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GART antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GART

Target: GART (Phosphoribosylglycinamide Formyltransferase (GART))

Alternative Name: GART (GART Products)

Synonyms: Gaps antibody, Prgs antibody, AIRS antibody, GARS antibody, GART-A antibody, gart antibody, phosphoribosylglycinamide formyltransferase antibody, phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase antibody, phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase L homeolog antibody, Gart antibody, GART antibody, gart.L antibody

Background: The protein encoded by this gene is a trifunctional polypeptide. It has phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase activity which is required for de novo purine biosynthesis. This enzyme is highly conserved in vertebrates. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Molecular Weight: 108 kDa (MW of target protein)