EPB41L2 antibody (Middle Region)

Catalog No. ABIN632791

Product Details anti-EPB41L2 Antibody

Target: EPB41L2 (erythrocyte Membrane Protein Band 4.1-Like 2 (EPB41L2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPB41L2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EPB41 L2 antibody was raised against the middle region of EPB41 2

Purification: Affinity purified

Immunogen: EPB41 L2 antibody was raised using the middle region of EPB41 2 corresponding to a region with amino acids AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPB41L2 Blocking Peptide, catalog no. 33R-1309, is also available for use as a blocking control in assays to test for specificity of this EPB41L2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPB41L2

Target: EPB41L2 (erythrocyte Membrane Protein Band 4.1-Like 2 (EPB41L2))

Alternative Name: EPB41L2 (EPB41L2 Products)

Synonyms: EPB41L2 antibody, 4.1-G antibody, 4.1G antibody, RGD1563977 antibody, AW555191 antibody, D10Ertd398e antibody, Epb41l2 antibody, NBL2 antibody, erythrocyte membrane protein band 4.1 like 2 antibody, erythrocyte membrane protein band 4.1-like 2 antibody, wu:fi46h04 antibody, EPB41L2 antibody, epb41l2 antibody, wu:fi46h04 antibody, Epb41l2 antibody

Background: EPB41L2 contains 1 FERM domain. The exact function of EPB41L2 remains unknown.

Molecular Weight: 66 kDa (MW of target protein)