FAM98B antibody (N-Term)
-
- Target See all FAM98B products
- FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM98B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM98 B antibody was raised against the N terminal of FAM98
- Purification
- Affinity purified
- Immunogen
- FAM98 B antibody was raised using the N terminal of FAM98 corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM98B Blocking Peptide, catalog no. 33R-5476, is also available for use as a blocking control in assays to test for specificity of this FAM98B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))
- Alternative Name
- FAM98B (FAM98B Products)
- Synonyms
- 2610510H03Rik antibody, RGD1564603 antibody, family with sequence similarity 98 member B antibody, family with sequence similarity 98, member B antibody, FAM98B antibody, Fam98b antibody
- Background
- The specific function of FAM98B is not yet known.
- Molecular Weight
- 45 kDa (MW of target protein)
-