PEPD antibody (Middle Region)

Catalog No. ABIN632867

Product Details anti-PEPD Antibody

Target: PEPD (Peptidase D (PEPD))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEPD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Peptidase D antibody was raised against the middle region of PEPD

Purification: Affinity purified

Immunogen: Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Peptidase D Blocking Peptide, catalog no. 33R-4964, is also available for use as a blocking control in assays to test for specificity of this Peptidase D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEPD

Target: PEPD (Peptidase D (PEPD))

Alternative Name: Peptidase D (PEPD Products)

Synonyms: MGC89151 antibody, DDBDRAFT_0190220 antibody, DDBDRAFT_0266378 antibody, DDB_0190220 antibody, DDB_0266378 antibody, PROLIDASE antibody, cb1000 antibody, fj78g11 antibody, wu:fj78g11 antibody, prolidase antibody, Pep-4 antibody, Pep4 antibody, peptidase D antibody, peptidase D L homeolog antibody, pepd antibody, pepD antibody, PEPD antibody, pepd.L antibody, Pepd antibody

Background: Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.

Molecular Weight: 54 kDa (MW of target protein)