PPID antibody
-
- Target See all PPID Antibodies
- PPID (Peptidylprolyl Isomerase D (PPID))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPID antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
- Top Product
- Discover our top product PPID Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPID Blocking Peptide, catalog no. 33R-1762, is also available for use as a blocking control in assays to test for specificity of this PPID antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPID antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPID (Peptidylprolyl Isomerase D (PPID))
- Alternative Name
- PPID (PPID Products)
- Synonyms
- PPID antibody, CYP-40 antibody, CYPD antibody, Cyp-40 antibody, CypD antibody, wu:fb18b07 antibody, zgc:86711 antibody, 4930564J03Rik antibody, Ppidl antibody, Ppif antibody, cyp-40 antibody, cypd antibody, peptidylprolyl isomerase D antibody, peptidylprolyl isomerase D (cyclophilin D) antibody, peptidylprolyl isomerase D (cyclophilin D) S homeolog antibody, PPID antibody, Ppid antibody, ppid antibody, ppid.S antibody
- Background
- PPID is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- Nuclear Hormone Receptor Binding
-