C22orf28 antibody (Middle Region)
-
- Target See all C22orf28 Antibodies
- C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C22orf28 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C22 ORF28 antibody was raised against the middle region of C22 rf28
- Purification
- Affinity purified
- Immunogen
- C22 ORF28 antibody was raised using the middle region of C22 rf28 corresponding to a region with amino acids EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC
- Top Product
- Discover our top product C22orf28 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C22ORF28 Blocking Peptide, catalog no. 33R-2666, is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))
- Alternative Name
- C22ORF28 (C22orf28 Products)
- Synonyms
- C1H22orf28 antibody, C22orf28 antibody, DJ149A16.6 antibody, FAAP antibody, RP1-149A16.6 antibody, c22orf28 antibody, C10H22orf28 antibody, MGC154502 antibody, HSPC117 antibody, AI255213 antibody, AI463255 antibody, RNA 2',3'-cyclic phosphate and 5'-OH ligase antibody, tRNA-splicing ligase RtcB homolog antibody, RTCB antibody, rtcb antibody, rtcb.L antibody, Rtcb antibody
- Background
- C22ORF28 is believed to be involved in vinculin binding.
- Molecular Weight
- 55 kDa (MW of target protein)
-